Chemical names · alphabetical database

Chemicals Starting with Q

Find chemicals whose preferred name or source synonym starts with Q. Browse the full list, check CAS numbers and formulas, or search within all 676 matching records.

Browse the database ↓ · Coverage and naming rules

676Matching chemical records

239With CAS cross-references

295ChEBI team annotated

Examples of chemicals starting with Q

Q56-85-9 · C5H10N2O3

QHS63968-64-9 · C15H22O5

Quinol123-31-9 · C6H6O2

quelina82-02-0 · C14H12O5

Quintex101-42-8 · C9H12N2O

quicklime1305-78-8 · Ca.O

Interactive filtering requires JavaScript. The complete alphabetical list is available through the page links and downloads.

676 records · showing 1–100

Chemicals starting with Q, page 1
Chemical & matching names	CAS number	Formula & mass	Annotation
QSource synonym · CHEBI:16389 Names & database links Source preferred name: ubiquinones Matching names: Q ChEBI record · PubChem search · CAS lookup	1339-63-5	(C5H8)n.C9H10O4250.294 g/mol	3-starChEBI team
QSource synonym · CHEBI:18050 Names & database links Source preferred name: L-glutamine Matching names: Q ChEBI record · PubChem search · CAS lookup	56-85-9	C5H10N2O3146.146 g/mol	3-starChEBI team
QSource synonym · CHEBI:30011 Names & database links Source preferred name: L-glutamine residue Matching names: Q ChEBI record	Not supplied	C5H8N2O2128.131 g/mol	3-starChEBI team
QSource synonym · CHEBI:46245 Names & database links Source preferred name: coenzyme Q10 Matching names: Q; Q 199; Q10 ChEBI record · PubChem search · CAS lookup	303-98-0	C59H90O4863.365 g/mol	3-starChEBI team
q-BH2Source synonym · CHEBI:43029 Names & database links Source preferred name: L-erythro-7,8-dihydrobiopterin Matching names: q-BH2; Quinonoid dihydrobiopterin ChEBI record · PubChem search · CAS lookup	6779-87-9	C9H13N5O3239.235 g/mol	3-starChEBI team
q-dihydrobiopterinSource synonym · CHEBI:20680 Names & database links Source preferred name: 6,7-dihydrobiopterin Matching names: q-dihydrobiopterin; Quinoid-dihydrobiopterin; quinoid-dihydrobiopterin ChEBI record	Not supplied	C9H13N5O3239.235 g/mol	3-starChEBI team
q-H2BPTSource synonym · CHEBI:43120 Names & database links Source preferred name: (6R)-L-erythro-6,7-dihydrobiopterin Matching names: q-H2BPT; Quinoid-dihydrobiopterin; quinonoid 6,7-dihydrobiopterin ChEBI record · PubChem search · CAS lookup	79647-29-3	C9H13N5O3239.235 g/mol	3-starChEBI team
Q-NH2Source synonym · CHEBI:21309 Names & database links Source preferred name: L-glutamine amide Matching names: Q-NH2 ChEBI record · PubChem search · CAS lookup	2013-17-4	C5H11N3O2145.162 g/mol	3-starChEBI team
Q-RoxinSource synonym · CHEBI:34553 Names & database links Source preferred name: Balofloxacin Matching names: Q-Roxin ChEBI record · PubChem search · CAS lookup	127294-70-6	C20H24FN3O4389.427 g/mol	2-starThird-party annotation
Q-VD-OPhPreferred name · CHEBI:233568 Names & database links Source preferred name: Q-VD-OPh Matching names: Q-VD-OPh; quinolyl-valyl-O-methylaspartyl-(2,6-difluorophenoxy)methyl ketone ChEBI record	Not supplied	C26H25F2N3O6513.497 g/mol	2-starThird-party annotation
Q-VD-OPh hydratePreferred name · CHEBI:232611 Names & database links Source preferred name: Q-VD-OPh hydrate Matching names: Q-VD-OPh hydrate; quinoline-Val-Asp-difluorophenoxymethylketone ChEBI record · PubChem search · CAS lookup	1135695-98-5	C26H25F2N3O6513.497 g/mol	2-starThird-party annotation
Q0Source synonym · CHEBI:27906 Names & database links Source preferred name: ubiquinone-0 Matching names: Q0 ChEBI record · PubChem search · CAS lookup	605-94-7	C9H10O4182.175 g/mol	3-starChEBI team
217882Q07PSource synonym · CHEBI:750821 Names & database links Source preferred name: bisbutytiamine Matching names: 217882Q07P ChEBI record	Not supplied	C32H46N8O6S2702.904 g/mol	2-starThird-party annotation
Q203Source synonym · CHEBI:755253 Names & database links Source preferred name: telacebec Matching names: Q-203; Q203 ChEBI record	Not supplied	C29H28ClF3N4O2557.016 g/mol	2-starThird-party annotation
QAB149Source synonym · CHEBI:68575 Names & database links Source preferred name: indacaterol Matching names: QAB 149; QAB-149; QAB149 ChEBI record · PubChem search · CAS lookup	312753-06-3	C24H28N2O3392.499 g/mol	3-starChEBI team
QACSource synonym · CHEBI:31264 Names & database links Source preferred name: benzethonium chloride Matching names: QAC; Quatrachlor ChEBI record · PubChem search · CAS lookup	121-54-0	C27H42NO2.Cl448.091 g/mol	3-starChEBI team
QapzolaSource synonym · CHEBI:177558 Names & database links Source preferred name: Apaziquone Matching names: Qapzola ChEBI record · PubChem search · CAS lookup	114560-48-4	C15H16N2O4288.303 g/mol	2-starThird-party annotation
qav680Preferred name · CHEBI:755044 Names & database links Source preferred name: qav680 Matching names: qav680; Qav-680; Qav-690 free acid; QAV680; QAV690 FREE ACID ChEBI record	Not supplied	C18H18N2O4S358.419 g/mol	2-starThird-party annotation
QAW039Source synonym · CHEBI:755160 Names & database links Source preferred name: fevipiprant Matching names: QAW-039; QAW039 ChEBI record	Not supplied	C19H17F3N2O4S426.416 g/mol	2-starThird-party annotation
QBP1Preferred name · CHEBI:233157 Names & database links Source preferred name: QBP1 Matching names: QBP1 ChEBI record	Not supplied	C72H90N16O161435.608 g/mol	2-starThird-party annotation
QBW251Source synonym · CHEBI:758218 Names & database links Source preferred name: icenticaftor Matching names: QBW-251; QBW251 ChEBI record	Not supplied	C12H13F6N3O3361.242 g/mol	2-starThird-party annotation
QC-11751Source synonym · CHEBI:755891 Names & database links Source preferred name: bemcentinib Matching names: QC-11751 ChEBI record	Not supplied	C30H34N8506.658 g/mol	2-starThird-party annotation
qc-12Preferred name · CHEBI:750202 Names & database links Source preferred name: qc-12 Matching names: qc-12; Qc-12 ChEBI record	Not supplied	C18H13NO10403.299 g/mol	2-starThird-party annotation
QC5487Source synonym · CHEBI:758260 Names & database links Source preferred name: trotabresib Matching names: QC-5487; QC5487 ChEBI record	Not supplied	C21H21NO4S383.469 g/mol	2-starThird-party annotation
QC6352Preferred name · CHEBI:232550 Names & database links Source preferred name: QC6352 Matching names: QC6352; QC 6352; QC-6352 ChEBI record · PubChem search · CAS lookup	1851373-36-8	C24H25N3O2387.483 g/mol	2-starThird-party annotation
QCBSource synonym · CHEBI:47136 Names & database links Source preferred name: pentachlorobenzene Matching names: QCB ChEBI record · PubChem search · CAS lookup	608-93-5	C6HCl5250.339 g/mol	3-starChEBI team
QCCSource synonym · CHEBI:144458 Names & database links Source preferred name: Gln-Cys-Cys Matching names: Q-C-C; QCC ChEBI record	Not supplied	C11H20N4O5S2352.438 g/mol	3-starChEBI team
QESource synonym · CHEBI:73847 Names & database links Source preferred name: Gln-Glu Matching names: QE ChEBI record	Not supplied	C10H17N3O6275.261 g/mol	3-starChEBI team
QFSource synonym · CHEBI:141430 Names & database links Source preferred name: Gln-Phe Matching names: Q-F; Q-F dipeptide; QF; QF dipeptide ChEBI record	Not supplied	C14H19N3O4293.323 g/mol	3-starChEBI team
QFWYSource synonym · CHEBI:73464 Names & database links Source preferred name: Gln-Phe-Trp-Tyr Matching names: Q-F-W-Y; QFWY ChEBI record	Not supplied	C34H38N6O7642.713 g/mol	3-starChEBI team
QFYSource synonym · CHEBI:156250 Names & database links Source preferred name: Gln-Phe-Tyr Matching names: Q-F-Y; QFY ChEBI record · PubChem search · CAS lookup	123432-68-8	C23H28N4O6456.499 g/mol	3-starChEBI team
QGSource synonym · CHEBI:73848 Names & database links Source preferred name: Gln-Gly Matching names: QG ChEBI record	Not supplied	C7H13N3O4203.198 g/mol	3-starChEBI team
QGC001Source synonym · CHEBI:756993 Names & database links Source preferred name: firibastat Matching names: Qgc-001; QGC001 ChEBI record	Not supplied	C8H20N2O6S4368.524 g/mol	2-starThird-party annotation
QGU42Source synonym · CHEBI:83268 Names & database links Source preferred name: oxathiapiprolin Matching names: QGU42 ChEBI record · PubChem search · CAS lookup	1003318-67-9	C24H22F5N5O2S539.521 g/mol	3-starChEBI team
QH2Source synonym · CHEBI:17976 Names & database links Source preferred name: ubiquinol Matching names: QH(2); QH2 ChEBI record · PubChem search · CAS lookup	56275-39-9	(C5H8)n.C9H12O4252.31 g/mol	3-starChEBI team
QHSSource synonym · CHEBI:223316 Names & database links Source preferred name: (+)-artemisinin Matching names: QHS; Qing Hau Sau; Qinghaosu; Quing Hau Sau ChEBI record · PubChem search · CAS lookup	63968-64-9	C15H22O5282.336 g/mol	3-starChEBI team
QingyangshengeninPreferred name · CHEBI:184101 Names & database links Source preferred name: Qingyangshengenin Matching names: Qingyangshengenin ChEBI record	Not supplied	C28H36O8500.588 g/mol	2-starThird-party annotation
QinichelinPreferred name · CHEBI:219028 Names & database links Source preferred name: Qinichelin Matching names: Qinichelin ChEBI record	Not supplied	C31H49N9O14771.782 g/mol	2-starThird-party annotation
Qinimycin APreferred name · CHEBI:206672 Names & database links Source preferred name: Qinimycin A Matching names: Qinimycin A ChEBI record	Not supplied	C23H27NO8445.468 g/mol	2-starThird-party annotation
Qinimycin BPreferred name · CHEBI:206678 Names & database links Source preferred name: Qinimycin B Matching names: Qinimycin B ChEBI record	Not supplied	C23H29NO9463.483 g/mol	2-starThird-party annotation
Qinimycin CPreferred name · CHEBI:206684 Names & database links Source preferred name: Qinimycin C Matching names: Qinimycin C ChEBI record	Not supplied	C24H31NO9477.51 g/mol	2-starThird-party annotation
Qinlactone APreferred name · CHEBI:210049 Names & database links Source preferred name: Qinlactone A Matching names: Qinlactone A ChEBI record	Not supplied	C16H22O4278.348 g/mol	2-starThird-party annotation
Qinlactone BPreferred name · CHEBI:210054 Names & database links Source preferred name: Qinlactone B Matching names: Qinlactone B ChEBI record	Not supplied	C16H22O4278.348 g/mol	2-starThird-party annotation
Qinlactone CPreferred name · CHEBI:210067 Names & database links Source preferred name: Qinlactone C Matching names: Qinlactone C ChEBI record	Not supplied	C16H24O6312.362 g/mol	2-starThird-party annotation
QinlockSource synonym · CHEBI:756647 Names & database links Source preferred name: ripretinib Matching names: Qinlock ChEBI record	Not supplied	C24H21BrFN5O2510.367 g/mol	2-starThird-party annotation
QINTAKWWKTHFPreferred name · CHEBI:90925 Names & database links Source preferred name: QINTAKWWKTHF Matching names: QINTAKWWKTHF ChEBI record	Not supplied	C75H106N20O171559.796 g/mol	3-starChEBI team
QKRSource synonym · CHEBI:144723 Names & database links Source preferred name: Gln-Lys-Arg Matching names: Q-K-R; QKR ChEBI record	Not supplied	C17H34N8O5430.51 g/mol	3-starChEBI team
QLSource synonym · CHEBI:141429 Names & database links Source preferred name: Gln-Leu Matching names: Q-L; Q-L dipeptide; QL; QL dipeptide ChEBI record	Not supplied	C11H21N3O4259.306 g/mol	3-starChEBI team
QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMAFSource synonym · CHEBI:75437 Names & database links Source preferred name: gastrin-34 Matching names: QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMAF ChEBI record · PubChem search · CAS lookup	53988-98-0	C176H253N43O54S3867.274 g/mol	3-starChEBI team
QLLPSource synonym · CHEBI:73463 Names & database links Source preferred name: Gln-Leu-Leu-Pro Matching names: Q-L-L-P; QLLP ChEBI record	Not supplied	C22H39N5O6469.583 g/mol	3-starChEBI team
QLT-091001Source synonym · CHEBI:757106 Names & database links Source preferred name: zuretinol acetate Matching names: QLT-091001 ChEBI record	Not supplied	C22H32O2328.496 g/mol	2-starThird-party annotation
QMHPreferred name · CHEBI:228410 Names & database links Source preferred name: QMH Matching names: QMH ChEBI record	Not supplied	C18H27NO4321.417 g/mol	2-starThird-party annotation
QNSource synonym · CHEBI:141428 Names & database links Source preferred name: Gln-Asn Matching names: Q-N; Q-N dipeptide; QN; QN dipeptide ChEBI record	Not supplied	C9H16N4O5260.25 g/mol	3-starChEBI team
qn-302Preferred name · CHEBI:758113 Names & database links Source preferred name: qn-302 Matching names: qn-302; Qn-302; QN302 ChEBI record	Not supplied	C45H57N7O6791.994 g/mol	2-starThird-party annotation
QN-Quinomycin APreferred name · CHEBI:202709 Names & database links Source preferred name: QN-Quinomycin A Matching names: QN-Quinomycin A ChEBI record	Not supplied	C53H66N10O12S21099.303 g/mol	2-starThird-party annotation
QN-Triostin APreferred name · CHEBI:217095 Names & database links Source preferred name: QN-Triostin A Matching names: QN-Triostin A ChEBI record	Not supplied	C52H64N10O12S21085.276 g/mol	2-starThird-party annotation
QNZSource synonym · CHEBI:232358 Names & database links Source preferred name: EVP4593 Matching names: QNZ ChEBI record · PubChem search · CAS lookup	545380-34-5	C22H20N4O356.429 g/mol	3-starChEBI team
QPX7728Source synonym · CHEBI:758109 Names & database links Source preferred name: xeruborbactam Matching names: QPX-7728; QPX7728 ChEBI record	Not supplied	C10H8BFO4221.98 g/mol	2-starThird-party annotation
QPX7728 sodiumSource synonym · CHEBI:760390 Names & database links Source preferred name: xeruborbactam sodium Matching names: QPX-7728 DISODIUM; QPX7728 DISODIUM; QPX7728 sodium ChEBI record	Not supplied	Na.C10H8BFO5.Na283.959 g/mol	2-starThird-party annotation
QPYMe2 fluorescent dyePreferred name · CHEBI:52248 Names & database links Source preferred name: QPYMe2 fluorescent dye Matching names: QPYMe2 fluorescent dye; QpyMe2 ChEBI record	Not supplied	C25H26N5396.518 g/mol	3-starChEBI team
QQSource synonym · CHEBI:73846 Names & database links Source preferred name: Gln-Gln Matching names: QQ ChEBI record	Not supplied	C10H18N4O5274.277 g/mol	3-starChEBI team
QQHPreferred name · CHEBI:228550 Names & database links Source preferred name: QQH Matching names: QQH ChEBI record	Not supplied	C19H22N2O3S358.463 g/mol	2-starThird-party annotation
QRPRLSHKGPMPSource synonym · CHEBI:149669 Names & database links Source preferred name: apelin-12 Matching names: Q-R-P-R-L-S-H-K-G-P-M-P; QRPRLSHKGPMP ChEBI record	Not supplied	C60H102N22O15S1403.682 g/mol	3-starChEBI team
QRPRLSHKGPMPFSource synonym · CHEBI:80131 Names & database links Source preferred name: apelin-13 Matching names: Q-R-P-R-L-S-H-K-G-P-M-P-F; QRPRLSHKGPMPF ChEBI record · PubChem search · CAS lookup	217082-58-1	C69H111N23O16S1550.859 g/mol	3-starChEBI team
QRX-431Source synonym · CHEBI:79988 Names & database links Source preferred name: Sobetirome Matching names: QRX-431 ChEBI record · PubChem search · CAS lookup	211110-63-3	C20H24O4328.408 g/mol	2-starThird-party annotation
QSSource synonym · CHEBI:157840 Names & database links Source preferred name: Gln-Ser Matching names: Q-S; Q-S dipeptide; QS; QS dipeptide ChEBI record · PubChem search · CAS lookup	5875-40-1	C8H15N3O5233.224 g/mol	3-starChEBI team
QS-7(1-)Preferred name · CHEBI:234175 Names & database links Source preferred name: QS-7(1-) Matching names: QS-7(1-) ChEBI record	Not supplied	C83H129O461862.899 g/mol	2-starThird-party annotation
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2Preferred name · CHEBI:84736 Names & database links Source preferred name: QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 Matching names: QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 ChEBI record	Not supplied	C145H227N45O49S23448.811 g/mol	3-starChEBI team
QSY21 succinimidyl esterPreferred name · CHEBI:52252 Names & database links Source preferred name: QSY21 succinimidyl ester Matching names: QSY21 succinimidyl ester; QSY 21 ChEBI record	Not supplied	C45H39N4O7S.Cl815.348 g/mol	3-starChEBI team
QSY21 succinimidyl ester(1+)Preferred name · CHEBI:52889 Names & database links Source preferred name: QSY21 succinimidyl ester(1+) Matching names: QSY21 succinimidyl ester(1+) ChEBI record	Not supplied	C45H39N4O7S779.895 g/mol	3-starChEBI team
QSY35 succinimidyl esterPreferred name · CHEBI:52253 Names & database links Source preferred name: QSY35 succinimidyl ester Matching names: QSY35 succinimidyl ester; QSY 35 ChEBI record	Not supplied	C18H13N5O7411.33 g/mol	3-starChEBI team
QSY7 succinimidyl esterPreferred name · CHEBI:52256 Names & database links Source preferred name: QSY7 succinimidyl ester Matching names: QSY7 succinimidyl ester; QSY 7 ChEBI record	Not supplied	C43H39N4O7S.Cl791.326 g/mol	3-starChEBI team
QSY7 succinimidyl ester(1+)Preferred name · CHEBI:52890 Names & database links Source preferred name: QSY7 succinimidyl ester(1+) Matching names: QSY7 succinimidyl ester(1+) ChEBI record	Not supplied	C43H39N4O7S755.873 g/mol	3-starChEBI team
QSY9 succinimidyl esterPreferred name · CHEBI:52259 Names & database links Source preferred name: QSY9 succinimidyl ester Matching names: QSY9 succinimidyl ester; QSY 9 ChEBI record	Not supplied	2H.C43H37N4O13S3.Cl951.454 g/mol	3-starChEBI team
QSY9 succinimidyl ester(1+)Preferred name · CHEBI:52891 Names & database links Source preferred name: QSY9 succinimidyl ester(1+) Matching names: QSY9 succinimidyl ester(1+) ChEBI record	Not supplied	C43H39N4O13S3916.001 g/mol	3-starChEBI team
Qu zhi shuSource synonym · CHEBI:31640 Names & database links Source preferred name: Furazabol Matching names: Qu zhi shu ChEBI record · PubChem search · CAS lookup	1239-29-8	C20H30N2O2330.472 g/mol	2-starThird-party annotation
quabodepistatPreferred name · CHEBI:758664 Names & database links Source preferred name: quabodepistat Matching names: quabodepistat ChEBI record	Not supplied	C21H20ClF3N2O4456.848 g/mol	2-starThird-party annotation
QuadazocinePreferred name · CHEBI:230107 Names & database links Source preferred name: Quadazocine Matching names: Quadazocine ChEBI record	Not supplied	C25H37NO2383.576 g/mol	2-starThird-party annotation
quadazocine mesylatePreferred name · CHEBI:752436 Names & database links Source preferred name: quadazocine mesylate Matching names: quadazocine mesylate; Quadazocine mesilate; Quadazocine mesylate ChEBI record	Not supplied	CH4O3S.C25H37NO2479.683 g/mol	2-starThird-party annotation
QuadoctomycinPreferred name · CHEBI:226567 Names & database links Source preferred name: Quadoctomycin Matching names: Quadoctomycin ChEBI record	Not supplied	C76H141NO231436.948 g/mol	2-starThird-party annotation
Quadrangolin APreferred name · CHEBI:173407 Names & database links Source preferred name: Quadrangolin A Matching names: Quadrangolin A ChEBI record	Not supplied	C15H22O3250.338 g/mol	2-starThird-party annotation
quadrangularin APreferred name · CHEBI:76192 Names & database links Source preferred name: quadrangularin A Matching names: quadrangularin A ChEBI record	Not supplied	C28H22O6454.478 g/mol	3-starChEBI team
quadranoside IVSource synonym · CHEBI:67952 Names & database links Source preferred name: 2alpha,3beta,23alpha-trihydroxyurs-12-en-28-oic acid 28-O-beta-D-glucopyranoside Matching names: quadranoside IV ChEBI record	Not supplied	C36H58O10650.85 g/mol	3-starChEBI team
QuadratsaeureSource synonym · CHEBI:52141 Names & database links Source preferred name: squaric acid Matching names: Quadratic acid; Quadratsaeure ChEBI record · PubChem search · CAS lookup	2892-51-5	C4H2O4114.056 g/mol	3-starChEBI team
Quadricinctafuran APreferred name · CHEBI:205815 Names & database links Source preferred name: Quadricinctafuran A Matching names: Quadricinctafuran A ChEBI record	Not supplied	C13H16O4236.267 g/mol	2-starThird-party annotation
Quadricinctafuran BPreferred name · CHEBI:205822 Names & database links Source preferred name: Quadricinctafuran B Matching names: Quadricinctafuran B ChEBI record	Not supplied	C13H16O5252.266 g/mol	2-starThird-party annotation
Quadricinctapyran APreferred name · CHEBI:205791 Names & database links Source preferred name: Quadricinctapyran A Matching names: Quadricinctapyran A ChEBI record	Not supplied	C12H12O4220.224 g/mol	2-starThird-party annotation
Quadricinctapyran BPreferred name · CHEBI:205797 Names & database links Source preferred name: Quadricinctapyran B Matching names: Quadricinctapyran B ChEBI record	Not supplied	C14H14O5262.261 g/mol	2-starThird-party annotation
Quadricinctone APreferred name · CHEBI:205779 Names & database links Source preferred name: Quadricinctone A Matching names: Quadricinctone A ChEBI record	Not supplied	C14H18O5266.293 g/mol	2-starThird-party annotation
Quadricinctone BPreferred name · CHEBI:205810 Names & database links Source preferred name: Quadricinctone B Matching names: Quadricinctone B ChEBI record	Not supplied	C12H14O4S254.307 g/mol	2-starThird-party annotation
Quadricinctone CPreferred name · CHEBI:205785 Names & database links Source preferred name: Quadricinctone C Matching names: Quadricinctone C ChEBI record	Not supplied	C12H14O6254.238 g/mol	2-starThird-party annotation
Quadricinctone DPreferred name · CHEBI:205829 Names & database links Source preferred name: Quadricinctone D Matching names: Quadricinctone D ChEBI record	Not supplied	C12H12O5236.223 g/mol	2-starThird-party annotation
QuadricinctoxepinePreferred name · CHEBI:205803 Names & database links Source preferred name: Quadricinctoxepine Matching names: Quadricinctoxepine ChEBI record	Not supplied	C12H12O4220.224 g/mol	2-starThird-party annotation
Quadrigemine APreferred name · CHEBI:8689 Names & database links Source preferred name: Quadrigemine A Matching names: Quadrigemine A ChEBI record · PubChem search · CAS lookup	69937-02-6	C44H50N8690.94 g/mol	2-starThird-party annotation
QuadrilineatinPreferred name · CHEBI:220777 Names & database links Source preferred name: Quadrilineatin Matching names: Quadrilineatin ChEBI record	Not supplied	C10H10O4194.186 g/mol	2-starThird-party annotation
quadriphenylSource synonym · CHEBI:52240 Names & database links Source preferred name: p-quaterphenyl Matching names: 1(1),2(1):2(4),3(1):3(4),4(1)-quaterphenyl; 1,1':4',1'':4'',1'''-quaterphenyl; quadriphenyl ChEBI record · PubChem search · CAS lookup	135-70-6	C24H18306.408 g/mol	3-starChEBI team
Quadriseptin APreferred name · CHEBI:199733 Names & database links Source preferred name: Quadriseptin A Matching names: Quadriseptin A ChEBI record	Not supplied	C13H12O5248.234 g/mol	2-starThird-party annotation
quadro-tetraaluminide(2-)Source synonym · CHEBI:35905 Names & database links Source preferred name: cyclo-tetraaluminide(2-) Matching names: quadro-tetraaluminide(2-) ChEBI record	Not supplied	Al4107.928 g/mol	3-starChEBI team
QuadronePreferred name · CHEBI:8690 Names & database links Source preferred name: Quadrone Matching names: Quadrone ChEBI record · PubChem search · CAS lookup	66550-08-1	C15H20O3248.322 g/mol	2-starThird-party annotation
Quaesitic acidPreferred name · CHEBI:227296 Names & database links Source preferred name: Quaesitic acid Matching names: Quaesitic acid ChEBI record	Not supplied	C22H14O13486.341 g/mol	2-starThird-party annotation

About this Q chemical list

What does “starting with Q” mean?

The preferred name or a source-listed synonym begins with Q, ignoring leading punctuation and numbers. Alphabetic prefixes such as D-, L-, N-, R-, S- and tert- are retained. A record appears once per letter, with its matching names grouped together. The same record can appear under another letter when it has a different name. Source synonyms can include trade names, abbreviations and names in other languages; they are labelled separately from preferred names.

How complete is the database?

This list includes every matching non-obsolete 2-star and 3-star entry with a formula, structure or valid CAS cross-reference in the downloaded ChEBI 256 snapshot. It excludes abstract classes without these substance identifiers. It is complete for that stated scope, not a list of every chemical known worldwide. ChEBI IDs define the records; related chemical forms are not merged solely because a CAS reference overlaps.

What do the data labels mean?

3-star entries are manually annotated by the ChEBI team; 2-star entries are annotated by third parties. “Not supplied” means that the source has no value for the field. CAS numbers are source cross-references with a valid checksum, not independent CAS verification. Formulas and masses retain source notation; the existing PubCAS profiles retain their documented editorial corrections. Search and lookup links may have no matching result.

Source: ChEBI downloads, EMBL-EBI · release 256 · retrieved 2026-10-11 · CC BY 4.0. Download coverage and source manifest. For handling or purchasing a chemical, verify the exact form and consult the supplier’s current SDS.