Chemical names · alphabetical database

Chemicals Starting with Y

Find chemicals whose preferred name or source synonym starts with Y. Browse the full list, check CAS numbers and formulas, or search within all 335 matching records.

Browse the database ↓ · Coverage and naming rules

335Matching chemical records

108With CAS cross-references

152ChEBI team annotated

Examples of chemicals starting with Y

Yttrium7440-65-5 · Y

ytterbium atom7440-64-4 · Yb

Y60-18-4 · C9H11NO3

YC 7331323-25-8 · C4H8CuN2O2S2

Y 921355843-86-2 · C16H14N2O2

YK-17653910-25-1 · C11H16N4O4

Interactive filtering requires JavaScript. The complete alphabetical list is available through the page links and downloads.

335 records · showing 1–100

Chemicals starting with Y, page 1
Chemical & matching names	CAS number	Formula & mass	Annotation
YSource synonym · CHEBI:17895 Names & database links Source preferred name: L-tyrosine Matching names: Y ChEBI record · PubChem search · CAS lookup	60-18-4	C9H11NO3181.191 g/mol	3-starChEBI team
YSource synonym · CHEBI:18186 Names & database links Source preferred name: tyrosine Matching names: Y ChEBI record · PubChem search · CAS lookup	55520-40-6 556-03-6	C9H11NO3181.191 g/mol	3-starChEBI team
YSource synonym · CHEBI:46858 Names & database links Source preferred name: L-tyrosine residue Matching names: Y ChEBI record	Not supplied	C9H9NO2163.176 g/mol	3-starChEBI team
Y 23684Preferred name · CHEBI:79404 Names & database links Source preferred name: Y 23684 Matching names: Y 23684 ChEBI record · PubChem search · CAS lookup	118288-67-8	C18H13ClN2O2S356.834 g/mol	2-starThird-party annotation
Y 3642Source synonym · CHEBI:135353 Names & database links Source preferred name: tinoridine Matching names: Y 3642; Y-3642 ChEBI record · PubChem search · CAS lookup	24237-54-5	C17H20N2O2S316.426 g/mol	2-starThird-party annotation
Y 5330Source synonym · CHEBI:135895 Names & database links Source preferred name: cargutocin Matching names: Y 5330 ChEBI record · PubChem search · CAS lookup	33605-67-3	C42H65N11O12916.047 g/mol	2-starThird-party annotation
Y 6124 FREE BASESource synonym · CHEBI:135376 Names & database links Source preferred name: bufetolol Matching names: Y 6124 FREE BASE; Y-6124 FREE BASE ChEBI record · PubChem search · CAS lookup	53684-49-4	C18H29NO4323.433 g/mol	2-starThird-party annotation
Y 9213Source synonym · CHEBI:76249 Names & database links Source preferred name: miroprofen Matching names: Y 9213; Y-9213 ChEBI record · PubChem search · CAS lookup	55843-86-2	C16H14N2O2266.3 g/mol	3-starChEBI team
2-(Y(E)-propenyl)-octa-4(E),6(Z)-diene-1,2diolPreferred name · CHEBI:209906 Names & database links Source preferred name: 2-(Y(E)-propenyl)-octa-4(E),6(Z)-diene-1,2diol Matching names: 2-(Y(E)-propenyl)-octa-4(E),6(Z)-diene-1,2diol ChEBI record	Not supplied	C11H18O2182.263 g/mol	2-starThird-party annotation
Y-14556Preferred name · CHEBI:203941 Names & database links Source preferred name: Y-14556 Matching names: Y-14556 ChEBI record	Not supplied	C14H20Cl2N2O5367.229 g/mol	2-starThird-party annotation
Y-23023Source synonym · CHEBI:31819 Names & database links Source preferred name: Mepranoprofen arbamel Matching names: Y-23023 ChEBI record · PubChem search · CAS lookup	118635-52-2	C20H22N2O4354.406 g/mol	2-starThird-party annotation
Y-27632Preferred name · CHEBI:75393 Names & database links Source preferred name: Y-27632 Matching names: Y-27632; Y 27632 ChEBI record · PubChem search · CAS lookup	146986-50-7	C14H21N3O247.342 g/mol	3-starChEBI team
Y-27632 dihydrochloridePreferred name · CHEBI:232591 Names & database links Source preferred name: Y-27632 dihydrochloride Matching names: Y-27632 dihydrochloride ChEBI record · PubChem search · CAS lookup	129830-38-2	C14H21N3O.2HCl320.264 g/mol	2-starThird-party annotation
Y-39983Source synonym · CHEBI:91412 Names & database links Source preferred name: 4-[(1R)-1-aminoethyl]-N-(1H-pyrrolo[2,3-b]pyridin-4-yl)benzamide Matching names: Y-39983; y-39983 ChEBI record	Not supplied	C16H16N4O280.331 g/mol	2-starThird-party annotation
Y-516Source synonym · CHEBI:135775 Names & database links Source preferred name: mosapramine Matching names: Y-516 ChEBI record · PubChem search · CAS lookup	89419-40-9	C28H35ClN4O479.07 g/mol	3-starChEBI team
Y-7131Source synonym · CHEBI:31583 Names & database links Source preferred name: Etizolam Matching names: Y-7131 ChEBI record · PubChem search · CAS lookup	40054-69-1	C17H15ClN4S342.855 g/mol	2-starThird-party annotation
Y-lactone 2Preferred name · CHEBI:205189 Names & database links Source preferred name: Y-lactone 2 Matching names: Y-lactone 2 ChEBI record	Not supplied	C7H10O5174.152 g/mol	2-starThird-party annotation
y-MorphinePreferred name · CHEBI:169477 Names & database links Source preferred name: y-Morphine Matching names: y-Morphine ChEBI record	Not supplied	C34H36N2O6568.67 g/mol	2-starThird-party annotation
Y-T0678HPreferred name · CHEBI:223012 Names & database links Source preferred name: Y-T0678H Matching names: Y-T0678H ChEBI record	Not supplied	C7H5NO3151.121 g/mol	2-starThird-party annotation
Y13161Source synonym · CHEBI:228214 Names & database links Source preferred name: benquitrione Matching names: Y13161 ChEBI record · PubChem search · CAS lookup	1639426-14-4	C24H22N2O5418.449 g/mol	3-starChEBI team
Y24180Source synonym · CHEBI:31736 Names & database links Source preferred name: Israpafant Matching names: Y24180 ChEBI record · PubChem search · CAS lookup	117279-73-9	C28H29ClN4S489.088 g/mol	2-starThird-party annotation
YASource synonym · CHEBI:74879 Names & database links Source preferred name: Tyr-Ala Matching names: YA ChEBI record	Not supplied	C12H16N2O4252.27 g/mol	3-starChEBI team
YADAIFTNSYRKVLGQLSARKLLQDIMSRSource synonym · CHEBI:9118 Names & database links Source preferred name: sermorelin Matching names: YADAIFTNSYRKVLGQLSARKLLQDIMSR ChEBI record · PubChem search · CAS lookup	86168-78-7	C149H246N44O42S3357.94 g/mol	3-starChEBI team
yadanziolide BPreferred name · CHEBI:68932 Names & database links Source preferred name: yadanziolide B Matching names: yadanziolide B ChEBI record	Not supplied	C20H26O11442.417 g/mol	3-starChEBI team
yadanziolide TPreferred name · CHEBI:68928 Names & database links Source preferred name: yadanziolide T Matching names: yadanziolide T ChEBI record	Not supplied	C20H28O8396.436 g/mol	3-starChEBI team
yadanziolide UPreferred name · CHEBI:68929 Names & database links Source preferred name: yadanziolide U Matching names: yadanziolide U ChEBI record	Not supplied	C26H38O13558.577 g/mol	3-starChEBI team
yadanziolide VPreferred name · CHEBI:68930 Names & database links Source preferred name: yadanziolide V Matching names: yadanziolide V ChEBI record	Not supplied	C19H26O8382.409 g/mol	3-starChEBI team
Yaequinolone B_120182Preferred name · CHEBI:182194 Names & database links Source preferred name: Yaequinolone B_120182 Matching names: Yaequinolone B_120182 ChEBI record	Not supplied	C21H21NO6383.4 g/mol	2-starThird-party annotation
yaequinolone CPreferred name · CHEBI:193557 Names & database links Source preferred name: yaequinolone C Matching names: yaequinolone C ChEBI record	Not supplied	C27H33NO7483.561 g/mol	2-starThird-party annotation
yaequinolone DPreferred name · CHEBI:193558 Names & database links Source preferred name: yaequinolone D Matching names: yaequinolone D ChEBI record	Not supplied	C27H33NO7483.561 g/mol	2-starThird-party annotation
yaequinolone EPreferred name · CHEBI:193077 Names & database links Source preferred name: yaequinolone E Matching names: yaequinolone E ChEBI record	Not supplied	C22H23NO5381.428 g/mol	2-starThird-party annotation
Yaequinolone FPreferred name · CHEBI:204234 Names & database links Source preferred name: Yaequinolone F Matching names: Yaequinolone F ChEBI record	Not supplied	C27H31NO6465.546 g/mol	2-starThird-party annotation
Yaequinolone J1Preferred name · CHEBI:215148 Names & database links Source preferred name: Yaequinolone J1 Matching names: Yaequinolone J1 ChEBI record	Not supplied	C27H31NO5449.547 g/mol	2-starThird-party annotation
Yaequinolone J2Preferred name · CHEBI:227445 Names & database links Source preferred name: Yaequinolone J2 Matching names: Yaequinolone J2 ChEBI record	Not supplied	C27H31NO5449.547 g/mol	2-starThird-party annotation
YageineSource synonym · CHEBI:28121 Names & database links Source preferred name: harmine Matching names: Yageine; Yajeine ChEBI record · PubChem search · CAS lookup	442-51-3	C13H12N2O212.252 g/mol	3-starChEBI team
yahyaxanthonePreferred name · CHEBI:66491 Names & database links Source preferred name: yahyaxanthone Matching names: yahyaxanthone ChEBI record	Not supplied	C22H22O8414.41 g/mol	3-starChEBI team
yakima yellow phosphoramiditePreferred name · CHEBI:51608 Names & database links Source preferred name: yakima yellow phosphoramidite Matching names: yakima yellow phosphoramidite ChEBI record	Not supplied	C48H61Cl4N2O11P1014.805 g/mol	3-starChEBI team
Yakuchinone-ASource synonym · CHEBI:66033 Names & database links Source preferred name: 1-(4'-hydroxy-3'-methoxyphenyl)-7-phenyl-3-heptanone Matching names: Yakuchinone-A ChEBI record · PubChem search · CAS lookup	78954-23-1	C20H24O3312.409 g/mol	3-starChEBI team
yamafulSource synonym · CHEBI:31360 Names & database links Source preferred name: Carmofur Matching names: yamaful ChEBI record · PubChem search · CAS lookup	61422-45-5	C11H16FN3O3257.265 g/mol	2-starThird-party annotation
Yamanakanic acidPreferred name · CHEBI:197306 Names & database links Source preferred name: Yamanakanic acid Matching names: Yamanakanic acid ChEBI record	Not supplied	C21H36O2320.517 g/mol	2-starThird-party annotation
YambolapSource synonym · CHEBI:31719 Names & database links Source preferred name: ipriflavone Matching names: Yambolap ChEBI record · PubChem search · CAS lookup	35212-22-7	C18H16O3280.323 g/mol	3-starChEBI team
Yamchaetoglobosin APreferred name · CHEBI:220769 Names & database links Source preferred name: Yamchaetoglobosin A Matching names: Yamchaetoglobosin A ChEBI record	Not supplied	C33H40N2O6560.691 g/mol	2-starThird-party annotation
Yaminterritrem APreferred name · CHEBI:205326 Names & database links Source preferred name: Yaminterritrem A Matching names: Yaminterritrem A ChEBI record	Not supplied	C27H32O7468.546 g/mol	2-starThird-party annotation
Yaminterritrem BPreferred name · CHEBI:219626 Names & database links Source preferred name: Yaminterritrem B Matching names: Yaminterritrem B ChEBI record	Not supplied	C27H32O7468.546 g/mol	2-starThird-party annotation
Yaminterritrem CPreferred name · CHEBI:206633 Names & database links Source preferred name: Yaminterritrem C Matching names: Yaminterritrem C ChEBI record	Not supplied	C28H34O7482.573 g/mol	2-starThird-party annotation
YamogeninPreferred name · CHEBI:10086 Names & database links Source preferred name: Yamogenin Matching names: Yamogenin ChEBI record · PubChem search · CAS lookup	512-06-1	C27H42O3414.63 g/mol	2-starThird-party annotation
Yamogenin 3-O-neohesperidosidePreferred name · CHEBI:10087 Names & database links Source preferred name: Yamogenin 3-O-neohesperidoside Matching names: Yamogenin 3-O-neohesperidoside ChEBI record · PubChem search · CAS lookup	110996-52-6	C39H62O12722.913 g/mol	2-starThird-party annotation
YanbaicaisuSource synonym · CHEBI:69499 Names & database links Source preferred name: Bergenin Matching names: Yanbaicaisu ChEBI record · PubChem search · CAS lookup	477-90-7	C14H16O9328.273 g/mol	2-starThird-party annotation
YangambinPreferred name · CHEBI:10088 Names & database links Source preferred name: Yangambin Matching names: Yangambin ChEBI record · PubChem search · CAS lookup	13060-14-5	C24H30O8446.496 g/mol	2-starThird-party annotation
Yangjinhualine APreferred name · CHEBI:201247 Names & database links Source preferred name: Yangjinhualine A Matching names: Yangjinhualine A ChEBI record	Not supplied	C11H10O4206.197 g/mol	2-starThird-party annotation
YangoninPreferred name · CHEBI:10089 Names & database links Source preferred name: Yangonin Matching names: Yangonin ChEBI record · PubChem search · CAS lookup	500-62-9	C15H14O4258.273 g/mol	2-starThird-party annotation
Yangpumicin APreferred name · CHEBI:216781 Names & database links Source preferred name: Yangpumicin A Matching names: Yangpumicin A ChEBI record	Not supplied	C26H17NO7455.422 g/mol	2-starThird-party annotation
Yangpumicin BPreferred name · CHEBI:216787 Names & database links Source preferred name: Yangpumicin B Matching names: Yangpumicin B ChEBI record	Not supplied	C26H21NO7459.454 g/mol	2-starThird-party annotation
Yangpumicin CPreferred name · CHEBI:216793 Names & database links Source preferred name: Yangpumicin C Matching names: Yangpumicin C ChEBI record	Not supplied	C26H21NO8475.453 g/mol	2-starThird-party annotation
Yangpumicin DPreferred name · CHEBI:216799 Names & database links Source preferred name: Yangpumicin D Matching names: Yangpumicin D ChEBI record	Not supplied	C26H21NO8475.453 g/mol	2-starThird-party annotation
Yangpumicin EPreferred name · CHEBI:216805 Names & database links Source preferred name: Yangpumicin E Matching names: Yangpumicin E ChEBI record	Not supplied	C26H21NO9491.452 g/mol	2-starThird-party annotation
Yangpumicin FPreferred name · CHEBI:225325 Names & database links Source preferred name: Yangpumicin F Matching names: Yangpumicin F ChEBI record	Not supplied	C26H17NO8471.421 g/mol	2-starThird-party annotation
Yangpumicin GPreferred name · CHEBI:225330 Names & database links Source preferred name: Yangpumicin G Matching names: Yangpumicin G ChEBI record	Not supplied	C26H17NO7455.422 g/mol	2-starThird-party annotation
Yanucamide APreferred name · CHEBI:212093 Names & database links Source preferred name: Yanucamide A Matching names: Yanucamide A ChEBI record	Not supplied	C33H47N3O7597.753 g/mol	2-starThird-party annotation
Yanucamide BPreferred name · CHEBI:201257 Names & database links Source preferred name: Yanucamide B Matching names: Yanucamide B ChEBI record	Not supplied	C34H49N3O7611.78 g/mol	2-starThird-party annotation
Yanuthone APreferred name · CHEBI:213464 Names & database links Source preferred name: Yanuthone A Matching names: Yanuthone A ChEBI record	Not supplied	C24H34O5402.531 g/mol	2-starThird-party annotation
Yanuthone BPreferred name · CHEBI:204508 Names & database links Source preferred name: Yanuthone B Matching names: Yanuthone B ChEBI record	Not supplied	C24H32O5400.515 g/mol	2-starThird-party annotation
Yanuthone CPreferred name · CHEBI:224684 Names & database links Source preferred name: Yanuthone C Matching names: Yanuthone C ChEBI record	Not supplied	C24H34O5402.531 g/mol	2-starThird-party annotation
yanuthone DPreferred name · CHEBI:133841 Names & database links Source preferred name: yanuthone D Matching names: yanuthone D ChEBI record	Not supplied	C28H38O8502.604 g/mol	3-starChEBI team
yanuthone EPreferred name · CHEBI:133840 Names & database links Source preferred name: yanuthone E Matching names: yanuthone E ChEBI record	Not supplied	C28H40O8504.62 g/mol	3-starChEBI team
yanuthone FPreferred name · CHEBI:133835 Names & database links Source preferred name: yanuthone F Matching names: yanuthone F ChEBI record	Not supplied	C22H32O4360.494 g/mol	3-starChEBI team
yanuthone GPreferred name · CHEBI:133839 Names & database links Source preferred name: yanuthone G Matching names: yanuthone G ChEBI record	Not supplied	C28H42O9522.635 g/mol	3-starChEBI team
yanuthone HPreferred name · CHEBI:133836 Names & database links Source preferred name: yanuthone H Matching names: yanuthone H ChEBI record	Not supplied	C22H32O5376.493 g/mol	3-starChEBI team
yanuthone IPreferred name · CHEBI:133837 Names & database links Source preferred name: yanuthone I Matching names: yanuthone I ChEBI record	Not supplied	C17H24O6324.373 g/mol	3-starChEBI team
yanuthone JPreferred name · CHEBI:133838 Names & database links Source preferred name: yanuthone J Matching names: yanuthone J ChEBI record	Not supplied	C28H42O9522.635 g/mol	3-starChEBI team
yanuthone KPreferred name · CHEBI:133035 Names & database links Source preferred name: yanuthone K Matching names: yanuthone K; yanuthone-K ChEBI record	Not supplied	C24H34O4386.532 g/mol	3-starChEBI team
yanuthone LPreferred name · CHEBI:133034 Names & database links Source preferred name: yanuthone L Matching names: yanuthone L; yanuthone-L ChEBI record	Not supplied	C24H34O5402.531 g/mol	3-starChEBI team
yanuthone MPreferred name · CHEBI:133036 Names & database links Source preferred name: yanuthone M Matching names: yanuthone M; yanuthone-M ChEBI record	Not supplied	C24H36O5404.547 g/mol	3-starChEBI team
yanuthone X1Preferred name · CHEBI:133095 Names & database links Source preferred name: yanuthone X1 Matching names: yanuthone X1 ChEBI record	Not supplied	C24H34O5402.531 g/mol	3-starChEBI team
yanuthone X2Preferred name · CHEBI:133037 Names & database links Source preferred name: yanuthone X2 Matching names: yanuthone X2; yanuthone-X2 ChEBI record	Not supplied	C22H32O4360.494 g/mol	3-starChEBI team
YarvitanSource synonym · CHEBI:751145 Names & database links Source preferred name: mitratapide Matching names: Yarvitan ChEBI record	Not supplied	C36H41ClN8O4S717.296 g/mol	2-starThird-party annotation
yatakemycinPreferred name · CHEBI:198627 Names & database links Source preferred name: yatakemycin Matching names: yatakemycin; (+)-yatakemycin ChEBI record	Not supplied	C35H29N5O8S679.711 g/mol	2-starThird-party annotation
3-yatakemycinyl-2′-deoxyadenosinePreferred name · CHEBI:760801 Names & database links Source preferred name: 3-yatakemycinyl-2′-deoxyadenosine Matching names: 3-yatakemycinyl-2′-deoxyadenosine; YTMA ChEBI record	Not supplied	C40H35N10O8S815.849 g/mol	2-starThird-party annotation
YateinSource synonym · CHEBI:4553 Names & database links Source preferred name: dihydroanhydropodorhizol Matching names: (-)-yatein; Yatein ChEBI record · PubChem search · CAS lookup	40456-50-6	C22H24O7400.427 g/mol	3-starChEBI team
YAX4981K2DSource synonym · CHEBI:747760 Names & database links Source preferred name: Cyc-116 Matching names: YAX4981K2D ChEBI record · PubChem search · CAS lookup	693228-63-6	C18H20N6OS368.466 g/mol	2-starThird-party annotation
yazumycin ASource synonym · CHEBI:60821 Names & database links Source preferred name: streptothricin F Matching names: yazumycin A ChEBI record · PubChem search · CAS lookup	3808-42-2	C19H34N8O8502.529 g/mol	3-starChEBI team
yazumycin A acidSource synonym · CHEBI:60823 Names & database links Source preferred name: streptothricin F acid Matching names: yazumycin A acid ChEBI record	Not supplied	C19H36N8O9520.544 g/mol	3-starChEBI team
yazumycin A(3+)Source synonym · CHEBI:60822 Names & database links Source preferred name: streptothricin F(3+) Matching names: yazumycin A tri-cation; yazumycin A(3+) ChEBI record	Not supplied	C19H37N8O8505.553 g/mol	3-starChEBI team
Yazumycin CSource synonym · CHEBI:67576 Names & database links Source preferred name: streptothricin E Matching names: Yazumycin C ChEBI record · PubChem search · CAS lookup	3776-38-3	C25H46N10O9630.704 g/mol	2-starThird-party annotation
yazumycinsSource synonym · CHEBI:26789 Names & database links Source preferred name: streptothricin Matching names: yazumycins ChEBI record	Not supplied	(C6H12N2O)1-7.C13H22N6O7502.529 g/mol	3-starChEBI team
yazumycins acidSource synonym · CHEBI:60826 Names & database links Source preferred name: streptothricin acid Matching names: yazumycins acid; yazumycins acids ChEBI record	Not supplied	(C6H12N2O)1-7.C13H24N6O8520.544 g/mol	3-starChEBI team
YC 170Preferred name · CHEBI:35049 Names & database links Source preferred name: YC 170 Matching names: YC 170 ChEBI record · PubChem search · CAS lookup	59946-73-5	C28H26ClN3O3487.987 g/mol	2-starThird-party annotation
YC 73Source synonym · CHEBI:222417 Names & database links Source preferred name: fluopsin C Matching names: YC 73; YC-73 ChEBI record · PubChem search · CAS lookup	31323-25-8	C4H8CuN2O2S2243.8 g/mol	3-starChEBI team
YC-1Source synonym · CHEBI:142430 Names & database links Source preferred name: lificiguat Matching names: YC-1 ChEBI record · PubChem search · CAS lookup	170632-47-0	C19H16N2O2304.349 g/mol	3-starChEBI team
YC-17Source synonym · CHEBI:29706 Names & database links Source preferred name: 10-deoxymethymycin Matching names: YC-17 ChEBI record · PubChem search · CAS lookup	11091-33-1	C25H43NO6453.62 g/mol	3-starChEBI team
YC-17(1+)Source synonym · CHEBI:63307 Names & database links Source preferred name: 10-deoxymethymycin(1+) Matching names: YC-17(1+) ChEBI record	Not supplied	C25H44NO6454.628 g/mol	3-starChEBI team
YC-93Source synonym · CHEBI:7551 Names & database links Source preferred name: nicardipine hydrochloride Matching names: YC-93 ChEBI record · PubChem search · CAS lookup	54527-84-3	C26H29N3O6.HCl515.994 g/mol	2-starThird-party annotation
YC-93 free baseSource synonym · CHEBI:7550 Names & database links Source preferred name: nicardipine Matching names: YC-93 free base ChEBI record · PubChem search · CAS lookup	55985-32-5	C26H29N3O6479.533 g/mol	3-starChEBI team
yct-529Preferred name · CHEBI:759847 Names & database links Source preferred name: yct-529 Matching names: yct-529; Yct-529; Yct-529 free acid; YCT529 ChEBI record	Not supplied	C29H25NO3435.523 g/mol	2-starThird-party annotation
YDSource synonym · CHEBI:141455 Names & database links Source preferred name: Tyr-Asp Matching names: Y-D; Y-D dipeptide; YD; YD dipeptide ChEBI record	Not supplied	C13H16N2O6296.279 g/mol	3-starChEBI team
YESource synonym · CHEBI:74883 Names & database links Source preferred name: Tyr-Glu Matching names: YE ChEBI record	Not supplied	C14H18N2O6310.306 g/mol	3-starChEBI team
yeast nucleic acidSource synonym · CHEBI:33697 Names & database links Source preferred name: ribonucleic acid Matching names: yeast nucleic acid ChEBI record · PubChem search · CAS lookup	63231-63-0	Not suppliedMass not supplied	3-starChEBI team
Yellamycin APreferred name · CHEBI:224499 Names & database links Source preferred name: Yellamycin A Matching names: Yellamycin A ChEBI record	Not supplied	C28H33NO9527.57 g/mol	2-starThird-party annotation
Yellamycin BPreferred name · CHEBI:224494 Names & database links Source preferred name: Yellamycin B Matching names: Yellamycin B ChEBI record	Not supplied	C36H48N2O11684.783 g/mol	2-starThird-party annotation
Yellamycin CPreferred name · CHEBI:224489 Names & database links Source preferred name: Yellamycin C Matching names: Yellamycin C ChEBI record	Not supplied	C28H33NO9527.57 g/mol	2-starThird-party annotation

About this Y chemical list

What does “starting with Y” mean?

The preferred name or a source-listed synonym begins with Y, ignoring leading punctuation and numbers. Alphabetic prefixes such as D-, L-, N-, R-, S- and tert- are retained. A record appears once per letter, with its matching names grouped together. The same record can appear under another letter when it has a different name. Source synonyms can include trade names, abbreviations and names in other languages; they are labelled separately from preferred names.

How complete is the database?

This list includes every matching non-obsolete 2-star and 3-star entry with a formula, structure or valid CAS cross-reference in the downloaded ChEBI 256 snapshot. It excludes abstract classes without these substance identifiers. It is complete for that stated scope, not a list of every chemical known worldwide. ChEBI IDs define the records; related chemical forms are not merged solely because a CAS reference overlaps.

What do the data labels mean?

3-star entries are manually annotated by the ChEBI team; 2-star entries are annotated by third parties. “Not supplied” means that the source has no value for the field. CAS numbers are source cross-references with a valid checksum, not independent CAS verification. Formulas and masses retain source notation; the existing PubCAS profiles retain their documented editorial corrections. Search and lookup links may have no matching result.

Source: ChEBI downloads, EMBL-EBI · release 256 · retrieved 2026-10-11 · CC BY 4.0. Download coverage and source manifest. For handling or purchasing a chemical, verify the exact form and consult the supplier’s current SDS.